Lineage for d1gkxa1 (1gkx A:38-185)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.29: Bromodomain-like [47363] (4 superfamilies) 
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (1 family) 
Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (2 proteins) Protein Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) [69014] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [69015] (3 PDB entries) 
Domain d1gkxa1: 1gkx A:38-185 [65266]
Other proteins in same PDB: d1gkxa2
Details for d1gkxa1
PDB Entry: 1gkx (more details), 2.3 Å
PDB Description: branched-chain alpha-ketoacid dehydrogenase kinase (bck)
SCOP Domain Sequences for d1gkxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gkxa1 a.29.5.1 (A:38-185) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus)}
vrltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhe
lyirafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvr
yfldktltsrlgirmlathhlalhedkp
SCOP Domain Coordinates for d1gkxa1:
Click to download the PDB-style file with coordinates for d1gkxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gkxa1:
- d1gkxa1 is new in SCOP 1.59
- d1gkxa1 appears in SCOP 1.61
- d1gkxa1 appears in the current release, SCOPe 2.08
View in 3D
