Lineage for d1gkub3 (1gku B:499-1054)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018324Fold e.10: Prokaryotic type I DNA topoisomerase [56711] (1 superfamily)
    4 domains: (1) Toprim alpha/beta; (2&4) "winged helix"-like; (3) barrel: n=6, S=8
  4. 3018325Superfamily e.10.1: Prokaryotic type I DNA topoisomerase [56712] (2 families) (S)
    duplication: the protein chain passing through the domains 2-4 makes two structural repeats
    The active site is formed by the toprim and "winged helix" domains (domains 1 and 4); these two domains are also found in the type II topoisomerase (DNA gyrase A) and in the alpha subunit of topoisomerase IV
  5. 3018326Family e.10.1.1: Prokaryotic type I DNA topoisomerase [56713] (4 proteins)
    domain 4 contains the catalytic tyrosine residue
  6. 3018347Protein Topoisomerase 'domain' of reverse gyrase [69890] (1 species)
  7. 3018348Species Archaeoglobus fulgidus [TaxId:2234] [69891] (2 PDB entries)
  8. 3018349Domain d1gkub3: 1gku B:499-1054 [65259]
    Other proteins in same PDB: d1gkub1, d1gkub2, d1gkub4

Details for d1gkub3

PDB Entry: 1gku (more details), 2.7 Å

PDB Description: reverse gyrase from archaeoglobus fulgidus
PDB Compounds: (B:) reverse gyrase

SCOPe Domain Sequences for d1gkub3:

Sequence, based on SEQRES records: (download)

>d1gkub3 e.10.1.1 (B:499-1054) Topoisomerase 'domain' of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}
qefdlikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvtasighvvd
litnrgfhgvlvngrfvpvyasikrcrdcgyqftedrescpkcgsenvdnsrsriealrk
lahdaefvivgtdpdtegekiawdlknllsgcgavkraefhevtrrailealeslrdvde
nlvkaqvvrriedrwigfvlsqklwerfnnrnlsagraqtlvlgwiidrfqesrerrkia
ivrdfdlvlehdeeefdltiklveereelrtplppyttetmlsdanrilkfsvkqtmqia
qelfenglityhrtdstrvsdvgqriakeylgddfvgrewgesgahecirptrpltrddv
qrliqegvlvveglrwehfalydlifrrfmasqcrpfkvvvkkysiefdgktaeeerivr
aegrayelyravwvknelptgtfrvkaevksvpkvlpftqseiiqmmkergigrpstyat
ivdrlfmrnyvvekygrmiptklgidvfrflvrryakfvsedrtrdlesrmdaiergeld
ylkaledmyaeiksid

Sequence, based on observed residues (ATOM records): (download)

>d1gkub3 e.10.1.1 (B:499-1054) Topoisomerase 'domain' of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}
qefdlikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvtasighvvd
litnrgfhgvlvngrfvpvyasikdnsrsriealrklahdaefvivgtdpdtegekiawd
lknllsgcgavkraefhevtrrailealeslrdvdenlvkaqvvrriedrwigfvlsqkl
werfnnrnlsagraqtlvlgwiidrfqesrerrkiaivrdfdlvlehdeeefdltiklve
ereelrtplppyttetmlsdanrilkfsvkqtmqiaqelfenglityhrtdstrvsdvgq
riakeylgddfvgrewgesgahecirptrpltrddvqrliqegvlvveglrwehfalydl
ifrrfmasqcrpfkvvvkkysiefdgktaeeerivraegrayelyravwvknelptgtfr
vkaevksvpkvlpftqseiiqmmkergigrpstyativdrlfmrnyvvekygrmiptklg
idvfrflvrryakfvsedrtrdlesrmdaiergeldylkaledmyaeiksid

SCOPe Domain Coordinates for d1gkub3:

Click to download the PDB-style file with coordinates for d1gkub3.
(The format of our PDB-style files is described here.)

Timeline for d1gkub3: