Lineage for d1gkub1 (1gku B:1-250)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831866Family c.37.1.16: Helicase-like "domain" of reverse gyrase [69496] (1 protein)
  6. 831867Protein Helicase-like "domain" of reverse gyrase [69497] (1 species)
    contains a mobile insertion of LEM/SAP-like HeH motif, residues 354-423
  7. 831868Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69498] (2 PDB entries)
  8. 831869Domain d1gkub1: 1gku B:1-250 [65257]
    Other proteins in same PDB: d1gkub3
    less ordered regions are modeled as poly-ALA

Details for d1gkub1

PDB Entry: 1gku (more details), 2.7 Å

PDB Description: reverse gyrase from archaeoglobus fulgidus
PDB Compounds: (B:) reverse gyrase

SCOP Domain Sequences for d1gkub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
aaaaaaaaaaaaaaaaaaaslclfpedfllkefveffrkcvgepraiqkmwakrilrkes
faataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgtenl
igyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkaskn
vdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssrit

SCOP Domain Coordinates for d1gkub1:

Click to download the PDB-style file with coordinates for d1gkub1.
(The format of our PDB-style files is described here.)

Timeline for d1gkub1: