Lineage for d1gkub1 (1gku B:1-250)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122753Family c.37.1.16: Helicase-like "domain" of reverse gyrase [69496] (1 protein)
  6. 122754Protein Helicase-like "domain" of reverse gyrase [69497] (1 species)
  7. 122755Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69498] (2 PDB entries)
  8. 122756Domain d1gkub1: 1gku B:1-250 [65257]
    Other proteins in same PDB: d1gkub3

Details for d1gkub1

PDB Entry: 1gku (more details), 2.7 Å

PDB Description: reverse gyrase from archaeoglobus fulgidus

SCOP Domain Sequences for d1gkub1:

Sequence, based on SEQRES records: (download)

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus}
aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaslclfpedfllkefveffrkcvgeprai
qkmwakrilrkesfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetir
kyaekagvgtenligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfif
vddvdailkasknvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqll
nfdigssrit

Sequence, based on observed residues (ATOM records): (download)

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus}
aaaaaaaaaaaaaaaaaaaslclfpedfllkefveffrkcvgepraiqkmwakrilrkes
faataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgtenl
igyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkaskn
vdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssrit

SCOP Domain Coordinates for d1gkub1:

Click to download the PDB-style file with coordinates for d1gkub1.
(The format of our PDB-style files is described here.)

Timeline for d1gkub1: