Class b: All beta proteins [48724] (165 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) |
Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein) |
Protein Transthyretin (synonym: prealbumin) [49474] (4 species) sandwich; 8 strands in 2 sheets |
Species Human (Homo sapiens) [TaxId:9606] [49475] (67 PDB entries) |
Domain d1gkod_: 1gko D: [65255] mutant |
PDB Entry: 1gko (more details), 2.1 Å
SCOP Domain Sequences for d1gkod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gkod_ b.3.4.1 (D:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]} cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvt
Timeline for d1gkod_: