Lineage for d1gkod_ (1gko D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106204Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 106285Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 106286Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 106287Protein Transthyretin (synonym: prealbumin) [49474] (3 species)
  7. 106291Species Human (Homo sapiens) [TaxId:9606] [49475] (40 PDB entries)
  8. 106357Domain d1gkod_: 1gko D: [65255]

Details for d1gkod_

PDB Entry: 1gko (more details), 2.1 Å

PDB Description: an engineered transthyretin monomer that is non-amyloidogenic - unless partially denatured

SCOP Domain Sequences for d1gkod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkod_ b.3.4.1 (D:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvt

SCOP Domain Coordinates for d1gkod_:

Click to download the PDB-style file with coordinates for d1gkod_.
(The format of our PDB-style files is described here.)

Timeline for d1gkod_: