Lineage for d1gkoc_ (1gko C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2768958Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2768959Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2768980Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
    Uniprot P02766 31-143
  8. 2769602Domain d1gkoc_: 1gko C: [65254]

Details for d1gkoc_

PDB Entry: 1gko (more details), 2.1 Å

PDB Description: an engineered transthyretin monomer that is non-amyloidogenic - unless partially denatured
PDB Compounds: (C:) Transthyretin

SCOPe Domain Sequences for d1gkoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkoc_ b.3.4.1 (C:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtn

SCOPe Domain Coordinates for d1gkoc_:

Click to download the PDB-style file with coordinates for d1gkoc_.
(The format of our PDB-style files is described here.)

Timeline for d1gkoc_: