SCOP 1.61: Domain d1gklb_: 1gkl B:

Lineage for d1gklb_ (1gkl B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (23 families)

5. Family c.69.1.2: Carboxylesterase [53487] (3 proteins)

6. Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [69580] (2 PDB entries)

8. Domain d1gklb_: 1gkl B: [65251]

Details for d1gklb_

PDB Entry: 1gkl, 1.4 Å

PDB Description: s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with ferulic acid

SCOP Domain Sequences for d1gklb_:

Sequence; same for both SEQRES and ATOM records:

>d1gklb_ c.69.1.2 (B:) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh

Timeline for d1gklb_:

• d1gklb_ first appeared in SCOP 1.59
  
• d1gklb_ appears in SCOP 1.63
  
• d1gklb_ appears in the current release, SCOPe 2.08, called d1gklb1