SCOPe 2.07: Domain d1gkkb1: 1gkk B:803-1077

Lineage for d1gkkb1 (1gkk B:803-1077)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (7 proteins)

6. Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries)

8. Domain d1gkkb1: 1gkk B:803-1077 [65249]
   Other proteins in same PDB: d1gkka2, d1gkkb2
   complexed with cd, gol

Details for d1gkkb1

PDB Entry: 1gkk, 1.6 Å

PDB Description: feruloyl esterase domain of xyny from clostridium thermocellum

PDB Compounds: (B:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d1gkkb1:

Sequence; same for both SEQRES and ATOM records:

>d1gkkb1 c.69.1.2 (B:803-1077) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhe

Timeline for d1gkkb1:

• d1gkkb1 first appeared in SCOP 1.59, called d1gkkb_
  
• d1gkkb1 appears in SCOPe 2.06
  
• d1gkkb1 appears in the current release, SCOPe 2.08