Lineage for d1gkka1 (1gkk A:803-1077)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151048Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 2151076Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)
  7. 2151077Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries)
  8. 2151080Domain d1gkka1: 1gkk A:803-1077 [65248]
    Other proteins in same PDB: d1gkka2, d1gkkb2
    complexed with cd, gol

Details for d1gkka1

PDB Entry: 1gkk (more details), 1.6 Å

PDB Description: feruloyl esterase domain of xyny from clostridium thermocellum
PDB Compounds: (A:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d1gkka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkka1 c.69.1.2 (A:803-1077) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhe

SCOPe Domain Coordinates for d1gkka1:

Click to download the PDB-style file with coordinates for d1gkka1.
(The format of our PDB-style files is described here.)

Timeline for d1gkka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gkka2