Lineage for d1gk8o_ (1gk8 O:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 413835Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 413836Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 413837Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 413838Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 413844Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (2 PDB entries)
  8. 413848Domain d1gk8o_: 1gk8 O: [65245]
    Other proteins in same PDB: d1gk8a1, d1gk8a2, d1gk8c1, d1gk8c2, d1gk8e1, d1gk8e2, d1gk8g1, d1gk8g2
    complexed with cap, egl, mg, mme

Details for d1gk8o_

PDB Entry: 1gk8 (more details), 1.4 Å

PDB Description: rubisco from chlamydomonas reinhardtii

SCOP Domain Sequences for d1gk8o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk8o_ d.73.1.1 (O:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii}
mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
lvqrp

SCOP Domain Coordinates for d1gk8o_:

Click to download the PDB-style file with coordinates for d1gk8o_.
(The format of our PDB-style files is described here.)

Timeline for d1gk8o_: