Lineage for d1gk8k_ (1gk8 K:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726778Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 726779Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 726780Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 726781Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 726787Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (4 PDB entries)
  8. 726789Domain d1gk8k_: 1gk8 K: [65243]
    Other proteins in same PDB: d1gk8a1, d1gk8a2, d1gk8c1, d1gk8c2, d1gk8e1, d1gk8e2, d1gk8g1, d1gk8g2

Details for d1gk8k_

PDB Entry: 1gk8 (more details), 1.4 Å

PDB Description: rubisco from chlamydomonas reinhardtii
PDB Compounds: (K:) ribulose bisphosphate carboxylase small chain 1

SCOP Domain Sequences for d1gk8k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk8k_ d.73.1.1 (K:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrp

SCOP Domain Coordinates for d1gk8k_:

Click to download the PDB-style file with coordinates for d1gk8k_.
(The format of our PDB-style files is described here.)

Timeline for d1gk8k_: