Lineage for d1gk8i_ (1gk8 I:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193350Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
  4. 193351Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 193352Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 193353Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 193359Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (2 PDB entries)
  8. 193360Domain d1gk8i_: 1gk8 I: [65242]
    Other proteins in same PDB: d1gk8a1, d1gk8a2, d1gk8c1, d1gk8c2, d1gk8e1, d1gk8e2, d1gk8g1, d1gk8g2

Details for d1gk8i_

PDB Entry: 1gk8 (more details), 1.4 Å

PDB Description: rubisco from chlamydomonas reinhardtii

SCOP Domain Sequences for d1gk8i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk8i_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii}
mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
lvqrp

SCOP Domain Coordinates for d1gk8i_:

Click to download the PDB-style file with coordinates for d1gk8i_.
(The format of our PDB-style files is described here.)

Timeline for d1gk8i_: