Lineage for d1gk8g1 (1gk8 G:150-475)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2447081Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2447082Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2447083Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2447107Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69403] (6 PDB entries)
  8. 2447127Domain d1gk8g1: 1gk8 G:150-475 [65240]
    Other proteins in same PDB: d1gk8a2, d1gk8c2, d1gk8e2, d1gk8g2, d1gk8i_, d1gk8k_, d1gk8m_, d1gk8o_
    complexed with cap, edo, mg

Details for d1gk8g1

PDB Entry: 1gk8 (more details), 1.4 Å

PDB Description: rubisco from chlamydomonas reinhardtii
PDB Compounds: (G:) ribulose-1,5 bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1gk8g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk8g1 c.1.14.1 (G:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d1gk8g1:

Click to download the PDB-style file with coordinates for d1gk8g1.
(The format of our PDB-style files is described here.)

Timeline for d1gk8g1: