Lineage for d1gk8e2 (1gk8 E:11-149)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192424Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
  5. 192425Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 192426Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 192438Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (2 PDB entries)
  8. 192441Domain d1gk8e2: 1gk8 E:11-149 [65239]
    Other proteins in same PDB: d1gk8a1, d1gk8c1, d1gk8e1, d1gk8g1, d1gk8i_, d1gk8k_, d1gk8m_, d1gk8o_

Details for d1gk8e2

PDB Entry: 1gk8 (more details), 1.4 Å

PDB Description: rubisco from chlamydomonas reinhardtii

SCOP Domain Sequences for d1gk8e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk8e2 d.58.9.1 (E:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

SCOP Domain Coordinates for d1gk8e2:

Click to download the PDB-style file with coordinates for d1gk8e2.
(The format of our PDB-style files is described here.)

Timeline for d1gk8e2: