| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (6 PDB entries) |
| Domain d1gk8a2: 1gk8 A:7-149 [65235] Other proteins in same PDB: d1gk8a1, d1gk8c1, d1gk8e1, d1gk8g1, d1gk8i_, d1gk8k_, d1gk8m_, d1gk8o_ complexed with cap, edo, mg |
PDB Entry: 1gk8 (more details), 1.4 Å
SCOPe Domain Sequences for d1gk8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gk8a2 d.58.9.1 (A:7-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
fkalralrledlrippayvktfv
Timeline for d1gk8a2: