Lineage for d1gk8a1 (1gk8 A:150-475)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174502Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 174503Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 174504Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 174516Species Chlamydomonas reinhardtii [TaxId:3055] [69403] (2 PDB entries)
  8. 174517Domain d1gk8a1: 1gk8 A:150-475 [65234]
    Other proteins in same PDB: d1gk8a2, d1gk8c2, d1gk8e2, d1gk8g2, d1gk8i_, d1gk8k_, d1gk8m_, d1gk8o_

Details for d1gk8a1

PDB Entry: 1gk8 (more details), 1.4 Å

PDB Description: rubisco from chlamydomonas reinhardtii

SCOP Domain Sequences for d1gk8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk8a1 c.1.14.1 (A:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOP Domain Coordinates for d1gk8a1:

Click to download the PDB-style file with coordinates for d1gk8a1.
(The format of our PDB-style files is described here.)

Timeline for d1gk8a1: