Lineage for d1gk3a_ (1gk3 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010395Family a.127.1.2: HAL/PAL-like [48572] (2 protein domains)
    Pfam PF00221
  6. 2010396Protein Histidine ammonia-lyase (HAL) [48573] (1 species)
  7. 2010397Species Pseudomonas putida [TaxId:303] [48574] (6 PDB entries)
  8. 2010406Domain d1gk3a_: 1gk3 A: [65233]
    complexed with gol, so4; mutant

Details for d1gk3a_

PDB Entry: 1gk3 (more details), 2.25 Å

PDB Description: histidine ammonia-lyase (hal) mutant d145a from pseudomonas putida
PDB Compounds: (A:) histidine ammonia-lyase

SCOPe Domain Sequences for d1gk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk3a_ a.127.1.2 (A:) Histidine ammonia-lyase (HAL) {Pseudomonas putida [TaxId: 303]}
teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
alialvnaevyphiplkgsvgasgalaplahmslvllgegkarykgqwlsatealavagl
epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
evlgieanavsdnplvfaaegdvisggnfhaepvamaadnlalaiaeigslserrislmm
dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
fapdiekavellakgsltgllpagvlpsl

SCOPe Domain Coordinates for d1gk3a_:

Click to download the PDB-style file with coordinates for d1gk3a_.
(The format of our PDB-style files is described here.)

Timeline for d1gk3a_: