Lineage for d1gk2d_ (1gk2 D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543916Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 543917Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 544018Family a.127.1.2: HAL/PAL-like [48572] (2 proteins)
    Pfam 00221
  6. 544019Protein Histidine ammonia-lyase (HAL) [48573] (1 species)
  7. 544020Species Pseudomonas putida [TaxId:303] [48574] (6 PDB entries)
  8. 544026Domain d1gk2d_: 1gk2 D: [65232]
    complexed with gol, so4; mutant

Details for d1gk2d_

PDB Entry: 1gk2 (more details), 1.9 Å

PDB Description: histidine ammonia-lyase (hal) mutant f329g from pseudomonas putida

SCOP Domain Sequences for d1gk2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk2d_ a.127.1.2 (D:) Histidine ammonia-lyase (HAL) {Pseudomonas putida}
teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
evlgieanavsdnplvfaaegdvisggnghaepvamaadnlalaiaeigslserrislmm
dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
fapdiekavellakgsltgllpagvlpsl

SCOP Domain Coordinates for d1gk2d_:

Click to download the PDB-style file with coordinates for d1gk2d_.
(The format of our PDB-style files is described here.)

Timeline for d1gk2d_: