Lineage for d1gk2c_ (1gk2 C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 217746Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 217747Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 217814Family a.127.1.2: Histidine ammonia-lyase (HAL) [48572] (1 protein)
  6. 217815Protein Histidine ammonia-lyase (HAL) [48573] (1 species)
  7. 217816Species Pseudomonas putida [TaxId:303] [48574] (6 PDB entries)
  8. 217820Domain d1gk2c_: 1gk2 C: [65231]

Details for d1gk2c_

PDB Entry: 1gk2 (more details), 1.9 Å

PDB Description: histidine ammonia-lyase (hal) mutant f329g from pseudomonas putida

SCOP Domain Sequences for d1gk2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk2c_ a.127.1.2 (C:) Histidine ammonia-lyase (HAL) {Pseudomonas putida}
teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
evlgieanavsdnplvfaaegdvisggnghaepvamaadnlalaiaeigslserrislmm
dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
fapdiekavellakgsltgllpagvlpsl

SCOP Domain Coordinates for d1gk2c_:

Click to download the PDB-style file with coordinates for d1gk2c_.
(The format of our PDB-style files is described here.)

Timeline for d1gk2c_: