Lineage for d1gk2b_ (1gk2 B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101198Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 101199Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 101260Family a.127.1.2: Histidine ammonia-lyase (HAL) [48572] (1 protein)
  6. 101261Protein Histidine ammonia-lyase (HAL) [48573] (1 species)
  7. 101262Species Pseudomonas putida [TaxId:303] [48574] (4 PDB entries)
  8. 101264Domain d1gk2b_: 1gk2 B: [65230]

Details for d1gk2b_

PDB Entry: 1gk2 (more details), 1.9 Å

PDB Description: histidine ammonia-lyase (hal) mutant f329g from pseudomonas putida

SCOP Domain Sequences for d1gk2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk2b_ a.127.1.2 (B:) Histidine ammonia-lyase (HAL) {Pseudomonas putida}
teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
evlgieanavsdnplvfaaegdvisggnghaepvamaadnlalaiaeigslserrislmm
dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
fapdiekavellakgsltgllpagvlpsl

SCOP Domain Coordinates for d1gk2b_:

Click to download the PDB-style file with coordinates for d1gk2b_.
(The format of our PDB-style files is described here.)

Timeline for d1gk2b_: