Lineage for d1gjzb_ (1gjz B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1194811Protein Ubiquitin [54238] (4 species)
  7. 1194820Species Human (Homo sapiens) [TaxId:9606] [54239] (101 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 1194998Domain d1gjzb_: 1gjz B: [65224]

Details for d1gjzb_

PDB Entry: 1gjz (more details)

PDB Description: solution structure of a dimeric n-terminal fragment of human ubiquitin
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d1gjzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjzb_ d.15.1.1 (B:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqle

SCOPe Domain Coordinates for d1gjzb_:

Click to download the PDB-style file with coordinates for d1gjzb_.
(The format of our PDB-style files is described here.)

Timeline for d1gjzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gjza_