SCOP 1.59: Domain d1gjzb_: 1gjz B:

Lineage for d1gjzb_ (1gjz B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.1: Ubiquitin-like [54236] (5 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (5 proteins)

6. Protein Ubiquitin [54238] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54239] (11 PDB entries)

8. Domain d1gjzb_: 1gjz B: [65224]

Details for d1gjzb_

PDB Entry: 1gjz

PDB Description: solution structure of a dimeric n-terminal fragment of human ubiquitin

SCOP Domain Sequences for d1gjzb_:

Sequence; same for both SEQRES and ATOM records:

>d1gjzb_ d.15.1.1 (B:) Ubiquitin {Human (Homo sapiens)}
gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqle

Timeline for d1gjzb_:

• d1gjzb_ is new in SCOP 1.59
  
• d1gjzb_ appears in SCOP 1.61
  
• d1gjzb_ appears in the current release, SCOPe 2.08