SCOPe 2.08: Domain d1gjzb_: 1gjz B:

Lineage for d1gjzb_ (1gjz B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin [54238] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries)
   Uniprot P62988
   identical sequence in many other species

8. Domain d1gjzb_: 1gjz B: [65224]
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1gjzb_

PDB Entry: 1gjz

PDB Description: solution structure of a dimeric n-terminal fragment of human ubiquitin

PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d1gjzb_:

Sequence; same for both SEQRES and ATOM records:

>d1gjzb_ d.15.1.1 (B:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqle

Timeline for d1gjzb_:

• d1gjzb_ first appeared in SCOP 1.59
  
• d1gjzb_ appears in SCOPe 2.07