Lineage for d1gjva2 (1gjv A:186-378)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973930Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 2973931Protein Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) [69805] (1 species)
  7. 2973932Species Norway rat (Rattus norvegicus) [TaxId:10116] [69806] (15 PDB entries)
  8. 2973946Domain d1gjva2: 1gjv A:186-378 [65221]
    Other proteins in same PDB: d1gjva1
    complexed with ags, cl, k, mg

Details for d1gjva2

PDB Entry: 1gjv (more details), 2.7 Å

PDB Description: branched-chain alpha-ketoacid dehydrogenase kinase (bck) complxed with atp-gamma-s
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase

SCOPe Domain Sequences for d1gjva2:

Sequence, based on SEQRES records: (download)

>d1gjva2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
aeastqdprisplfghldmhsggqsgpmhgfgfglptsrayaeylggslqlqslqgigtd
vylrlrhidgree

Sequence, based on observed residues (ATOM records): (download)

>d1gjva2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
agfgfglptsrayaeylggslqlqslqgigtdvylrlrhidgree

SCOPe Domain Coordinates for d1gjva2:

Click to download the PDB-style file with coordinates for d1gjva2.
(The format of our PDB-style files is described here.)

Timeline for d1gjva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gjva1