Lineage for d1gjva1 (1gjv A:38-185)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267072Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1267633Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1267634Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)
  6. 1267635Protein Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) [69014] (1 species)
  7. 1267636Species Norway rat (Rattus norvegicus) [TaxId:10116] [69015] (3 PDB entries)
  8. 1267639Domain d1gjva1: 1gjv A:38-185 [65220]
    Other proteins in same PDB: d1gjva2
    complexed with ags, cl, k, mg

Details for d1gjva1

PDB Entry: 1gjv (more details), 2.7 Å

PDB Description: branched-chain alpha-ketoacid dehydrogenase kinase (bck) complxed with atp-gamma-s
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase

SCOPe Domain Sequences for d1gjva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjva1 a.29.5.1 (A:38-185) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vrltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhe
lyirafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvr
yfldktltsrlgirmlathhlalhedkp

SCOPe Domain Coordinates for d1gjva1:

Click to download the PDB-style file with coordinates for d1gjva1.
(The format of our PDB-style files is described here.)

Timeline for d1gjva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gjva2