![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (1 family) ![]() |
![]() | Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (2 proteins) |
![]() | Protein Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) [69014] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [69015] (3 PDB entries) |
![]() | Domain d1gjva1: 1gjv A:38-185 [65220] Other proteins in same PDB: d1gjva2 complexed with cl, k, mg, sap |
PDB Entry: 1gjv (more details), 2.7 Å
SCOPe Domain Sequences for d1gjva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gjva1 a.29.5.1 (A:38-185) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Norway rat (Rattus norvegicus) [TaxId: 10116]} vrltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhe lyirafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvr yfldktltsrlgirmlathhlalhedkp
Timeline for d1gjva1: