Lineage for d1gjva1 (1gjv A:38-185)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767485Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 767630Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (1 family) (S)
  5. 767631Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (2 proteins)
  6. 767632Protein Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) [69014] (1 species)
  7. 767633Species Rat (Rattus norvegicus) [TaxId:10116] [69015] (3 PDB entries)
  8. 767636Domain d1gjva1: 1gjv A:38-185 [65220]
    Other proteins in same PDB: d1gjva2
    complexed with cl, k, mg, sap

Details for d1gjva1

PDB Entry: 1gjv (more details), 2.7 Å

PDB Description: branched-chain alpha-ketoacid dehydrogenase kinase (bck) complxed with atp-gamma-s
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase

SCOP Domain Sequences for d1gjva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjva1 a.29.5.1 (A:38-185) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]}
vrltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhe
lyirafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvr
yfldktltsrlgirmlathhlalhedkp

SCOP Domain Coordinates for d1gjva1:

Click to download the PDB-style file with coordinates for d1gjva1.
(The format of our PDB-style files is described here.)

Timeline for d1gjva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gjva2