Lineage for d1gjva1 (1gjv A:38-185)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.29: Bromodomain-like [47363] (4 superfamilies) 
Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (1 family) 
Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (2 proteins) Protein Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) [69014] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [69015] (3 PDB entries) 
Domain d1gjva1: 1gjv A:38-185 [65220]
Other proteins in same PDB: d1gjva2
Details for d1gjva1
PDB Entry: 1gjv (more details), 2.7 Å
PDB Description: branched-chain alpha-ketoacid dehydrogenase kinase (bck) complxed with atp-gamma-s
SCOP Domain Sequences for d1gjva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gjva1 a.29.5.1 (A:38-185) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus)}
vrltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhe
lyirafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvr
yfldktltsrlgirmlathhlalhedkp
SCOP Domain Coordinates for d1gjva1:
Click to download the PDB-style file with coordinates for d1gjva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gjva1:
- d1gjva1 first appeared in SCOP 1.59
- d1gjva1 appears in SCOP 1.63
- d1gjva1 appears in the current release, SCOPe 2.08
View in 3D
