SCOPe 2.08: Domain d1gi9.1: 1gi9 A:,B:

Lineage for d1gi9.1 (1gi9 A:,B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (101 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d1gi9.1: 1gi9 A:,B: [65216]
   complexed with 123, cit

Details for d1gi9.1

PDB Entry: 1gi9, 1.8 Å

PDB Description: a novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site

PDB Compounds: (A:) urokinase-type plasminogen activator, (B:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d1gi9.1:

Sequence; same for both SEQRES and ATOM records:

>g1gi9.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lkfqcgqktXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfid
ypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrc
aqpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqp
hyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgv
ytrvshflpwirsht

Timeline for d1gi9.1:

• d1gi9.1 first appeared in SCOP 1.59
  
• d1gi9.1 appears in SCOPe 2.07