SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1gi1a_ (1gi1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056829Protein Trypsin(ogen) [50515] (9 species)
  7. 2056847Species Cow (Bos taurus) [TaxId:9913] [50516] (403 PDB entries)
    Uniprot P00760
  8. 2056899Domain d1gi1a_: 1gi1 A: [65208]
    complexed with bmz, ca, so4

Details for d1gi1a_

PDB Entry: 1gi1 (more details), 1.42 Å

PDB Description: a novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
PDB Compounds: (A:) beta-trypsin

SCOPe Domain Sequences for d1gi1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gi1a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1gi1a_:

Click to download the PDB-style file with coordinates for d1gi1a_.
(The format of our PDB-style files is described here.)

Timeline for d1gi1a_: