Lineage for d1gh7b4 (1gh7 B:317-416)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371700Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. 2371701Species Human (Homo sapiens) [TaxId:9606] [49290] (5 PDB entries)
  8. 2371718Domain d1gh7b4: 1gh7 B:317-416 [65201]

Details for d1gh7b4

PDB Entry: 1gh7 (more details), 3 Å

PDB Description: crystal structure of the complete extracellular domain of the beta- common receptor of il-3, il-5, and gm-csf
PDB Compounds: (B:) cytokine receptor common beta chain

SCOPe Domain Sequences for d1gh7b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh7b4 b.1.2.1 (B:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
svniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqna
hsmalpalepstrywarvrvrtsrtgyngiwsewsearsw

SCOPe Domain Coordinates for d1gh7b4:

Click to download the PDB-style file with coordinates for d1gh7b4.
(The format of our PDB-style files is described here.)

Timeline for d1gh7b4: