![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species) duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49290] (4 PDB entries) |
![]() | Domain d1gh7b4: 1gh7 B:317-416 [65201] |
PDB Entry: 1gh7 (more details), 3 Å
SCOPe Domain Sequences for d1gh7b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gh7b4 b.1.2.1 (B:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} svniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqna hsmalpalepstrywarvrvrtsrtgyngiwsewsearsw
Timeline for d1gh7b4:
![]() Domains from other chains: (mouse over for more information) d1gh7a1, d1gh7a2, d1gh7a3, d1gh7a4 |