Lineage for d1gh7b2 (1gh7 B:104-217)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787437Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 787438Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
    Pfam PF00041
  6. 787446Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. 787447Species Human (Homo sapiens) [TaxId:9606] [49290] (4 PDB entries)
  8. 787462Domain d1gh7b2: 1gh7 B:104-217 [65199]

Details for d1gh7b2

PDB Entry: 1gh7 (more details), 3 Å

PDB Description: crystal structure of the complete extracellular domain of the beta- common receptor of il-3, il-5, and gm-csf
PDB Compounds: (B:) cytokine receptor common beta chain

SCOP Domain Sequences for d1gh7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh7b2 b.1.2.1 (B:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
tqhvqppeprdlqistdqdhflltwsvalgspqshwlspgdlefevvykrlqdswedaai
llsntsqatlgpehlmpsstyvarvrtrlapgsrlsgrpskwspevcwdsqpgd

SCOP Domain Coordinates for d1gh7b2:

Click to download the PDB-style file with coordinates for d1gh7b2.
(The format of our PDB-style files is described here.)

Timeline for d1gh7b2: