Lineage for d1gh7b1 (1gh7 B:1-103)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290499Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 290500Family b.1.2.1: Fibronectin type III [49266] (20 proteins)
  6. 290501Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerises by swapping the C-terminal strands of domains 1 and 3
  7. 290502Species Human (Homo sapiens) [TaxId:9606] [49290] (3 PDB entries)
  8. 290508Domain d1gh7b1: 1gh7 B:1-103 [65198]

Details for d1gh7b1

PDB Entry: 1gh7 (more details), 3 Å

PDB Description: crystal structure of the complete extracellular domain of the beta- common receptor of il-3, il-5, and gm-csf

SCOP Domain Sequences for d1gh7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh7b1 b.1.2.1 (B:1-103) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens)}
eetiplqtlrcyndytshitcrwadtqdaqrlvnvtlirrvnedllepvscdlsddmpws
acphprcvprrcvipcqsfvvtdvdyfsfqpdrplgtrltvtl

SCOP Domain Coordinates for d1gh7b1:

Click to download the PDB-style file with coordinates for d1gh7b1.
(The format of our PDB-style files is described here.)

Timeline for d1gh7b1: