SCOP 1.59: Domain d1gh7a4: 1gh7 A:317-416

Lineage for d1gh7a4 (1gh7 A:317-416)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49290] (3 PDB entries)

8. Domain d1gh7a4: 1gh7 A:317-416 [65197]

Details for d1gh7a4

PDB Entry: 1gh7, 3 Å

PDB Description: crystal structure of the complete extracellular domain of the beta- common receptor of il-3, il-5, and gm-csf

SCOP Domain Sequences for d1gh7a4:

Sequence; same for both SEQRES and ATOM records:

>d1gh7a4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens)}
svniqmappslqvtkdgdsyslrwetmkmryehidhtfeiqyrkdtatwkdsktetlqna
hsmalpalepstrywarvrvrtsrtgyngiwsewsearsw

Timeline for d1gh7a4:

• d1gh7a4 is new in SCOP 1.59
  
• d1gh7a4 appears in SCOP 1.61
  
• d1gh7a4 appears in the current release, SCOPe 2.08