Lineage for d1gh7a1 (1gh7 A:1-103)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105237Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
  7. 105238Species Human (Homo sapiens) [TaxId:9606] [49290] (3 PDB entries)
  8. 105240Domain d1gh7a1: 1gh7 A:1-103 [65194]

Details for d1gh7a1

PDB Entry: 1gh7 (more details), 3 Å

PDB Description: crystal structure of the complete extracellular domain of the beta- common receptor of il-3, il-5, and gm-csf

SCOP Domain Sequences for d1gh7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh7a1 b.1.2.1 (A:1-103) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens)}
eetiplqtlrcyndytshitcrwadtqdaqrlvnvtlirrvnedllepvscdlsddmpws
acphprcvprrcvipcqsfvvtdvdyfsfqpdrplgtrltvtl

SCOP Domain Coordinates for d1gh7a1:

Click to download the PDB-style file with coordinates for d1gh7a1.
(The format of our PDB-style files is described here.)

Timeline for d1gh7a1: