Lineage for d1gh7a1 (1gh7 A:1-103)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761690Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. 2761691Species Human (Homo sapiens) [TaxId:9606] [49290] (5 PDB entries)
  8. 2761701Domain d1gh7a1: 1gh7 A:1-103 [65194]

Details for d1gh7a1

PDB Entry: 1gh7 (more details), 3 Å

PDB Description: crystal structure of the complete extracellular domain of the beta- common receptor of il-3, il-5, and gm-csf
PDB Compounds: (A:) cytokine receptor common beta chain

SCOPe Domain Sequences for d1gh7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh7a1 b.1.2.1 (A:1-103) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
eetiplqtlrcyndytshitcrwadtqdaqrlvnvtlirrvnedllepvscdlsddmpws
acphprcvprrcvipcqsfvvtdvdyfsfqpdrplgtrltvtl

SCOPe Domain Coordinates for d1gh7a1:

Click to download the PDB-style file with coordinates for d1gh7a1.
(The format of our PDB-style files is described here.)

Timeline for d1gh7a1: