Lineage for d1gh6b2 (1gh6 B:645-772)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540337Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 540338Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 540513Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)
  6. 540514Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
    contains an additional C-terminal helix
  7. 540515Species Human (Homo sapiens) [TaxId:9606] [47971] (5 PDB entries)
  8. 540532Domain d1gh6b2: 1gh6 B:645-772 [65193]
    Other proteins in same PDB: d1gh6a_

Details for d1gh6b2

PDB Entry: 1gh6 (more details), 3.2 Å

PDB Description: retinoblastoma pocket complexed with sv40 large t antigen

SCOP Domain Sequences for d1gh6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh6b2 a.74.1.3 (B:645-772) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)}
tslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqim
mcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqrl
ktnilqya

SCOP Domain Coordinates for d1gh6b2:

Click to download the PDB-style file with coordinates for d1gh6b2.
(The format of our PDB-style files is described here.)

Timeline for d1gh6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gh6b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1gh6a_