SCOP 1.61: Domain d1gh6b2: 1gh6 B:645-772

Lineage for d1gh6b2 (1gh6 B:645-772)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (3 PDB entries)

8. Domain d1gh6b2: 1gh6 B:645-772 [65193]
   Other proteins in same PDB: d1gh6a_

Details for d1gh6b2

PDB Entry: 1gh6, 3.2 Å

PDB Description: retinoblastoma pocket complexed with sv40 large t antigen

SCOP Domain Sequences for d1gh6b2:

Sequence; same for both SEQRES and ATOM records:

>d1gh6b2 a.74.1.3 (B:645-772) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)}
tslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqim
mcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqrl
ktnilqya

Timeline for d1gh6b2:

• d1gh6b2 first appeared in SCOP 1.59
  
• d1gh6b2 appears in SCOP 1.63
  
• d1gh6b2 appears in the current release, SCOPe 2.08