SCOPe 2.06: Domain d1gh6b1: 1gh6 B:379-583

Lineage for d1gh6b1 (1gh6 B:379-583)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)

8. Domain d1gh6b1: 1gh6 B:379-583 [65192]
   Other proteins in same PDB: d1gh6a_

Details for d1gh6b1

PDB Entry: 1gh6, 3.2 Å

PDB Description: retinoblastoma pocket complexed with sv40 large t antigen

PDB Compounds: (B:) Retinoblastoma-associated protein

SCOPe Domain Sequences for d1gh6b1:

Sequence, based on SEQRES records:

>d1gh6b1 a.74.1.3 (B:379-583) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagc
vaigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
srstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrim
eslawlsdsplfdlikqsklvprgs

Sequence, based on observed residues (ATOM records):

>d1gh6b1 a.74.1.3 (B:379-583) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagc
vaigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
srsttdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawls
dsplfdlikqsklvprgs

Timeline for d1gh6b1:

• d1gh6b1 first appeared in SCOP 1.59
  
• d1gh6b1 appears in SCOPe 2.05
  
• d1gh6b1 appears in SCOPe 2.07
  
• d1gh6b1 appears in the current release, SCOPe 2.08