Lineage for d1gh6a_ (1gh6 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437311Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 437342Superfamily a.2.3: Chaperone J-domain [46565] (1 family) (S)
  5. 437343Family a.2.3.1: Chaperone J-domain [46566] (6 proteins)
  6. 437365Protein Large T antigen, the N-terminal J domain [46573] (2 species)
  7. 437368Species Simian virus 40, Sv40 [TaxId:10633] [68943] (1 PDB entry)
  8. 437369Domain d1gh6a_: 1gh6 A: [65191]
    Other proteins in same PDB: d1gh6b1, d1gh6b2
    extended at the C-terminus

Details for d1gh6a_

PDB Entry: 1gh6 (more details), 3.2 Å

PDB Description: retinoblastoma pocket complexed with sv40 large t antigen

SCOP Domain Sequences for d1gh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40}
shmreeslqlmdllglersawgniplmrkaylkkckefhpdkggdeekmkkmntlykkme
dgvkyahqpdfggfwdateiptygtdeweqwwnafneenlfcseempssddeat

SCOP Domain Coordinates for d1gh6a_:

Click to download the PDB-style file with coordinates for d1gh6a_.
(The format of our PDB-style files is described here.)

Timeline for d1gh6a_: