| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
| Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
| Species Thermococcus kodakaraensis [TaxId:311400] [69731] (2 PDB entries) |
| Domain d1gehe2: 1geh E:12-136 [65190] Other proteins in same PDB: d1geha1, d1gehb1, d1gehc1, d1gehd1, d1gehe1 complexed with so4 |
PDB Entry: 1geh (more details), 2.8 Å
SCOPe Domain Sequences for d1gehe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gehe2 d.58.9.1 (E:12-136) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Thermococcus kodakaraensis [TaxId: 311400]}
yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
liref
Timeline for d1gehe2: