Lineage for d1gehe2 (1geh E:12-136)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652842Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1652843Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1652844Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1653008Species Thermococcus kodakaraensis [TaxId:311400] [69731] (2 PDB entries)
  8. 1653023Domain d1gehe2: 1geh E:12-136 [65190]
    Other proteins in same PDB: d1geha1, d1gehb1, d1gehc1, d1gehd1, d1gehe1
    complexed with so4

Details for d1gehe2

PDB Entry: 1geh (more details), 2.8 Å

PDB Description: crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)
PDB Compounds: (E:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1gehe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gehe2 d.58.9.1 (E:12-136) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Thermococcus kodakaraensis [TaxId: 311400]}
yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
liref

SCOPe Domain Coordinates for d1gehe2:

Click to download the PDB-style file with coordinates for d1gehe2.
(The format of our PDB-style files is described here.)

Timeline for d1gehe2: