Lineage for d1gehd1 (1geh D:137-443)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088462Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 2088634Species Thermococcus kodakaraensis [TaxId:311400] [69404] (2 PDB entries)
  8. 2088648Domain d1gehd1: 1geh D:137-443 [65187]
    Other proteins in same PDB: d1geha2, d1gehb2, d1gehc2, d1gehd2, d1gehe2
    complexed with so4

Details for d1gehd1

PDB Entry: 1geh (more details), 2.8 Å

PDB Description: crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)
PDB Compounds: (D:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1gehd1:

Sequence, based on SEQRES records: (download)

>d1gehd1 c.1.14.1 (D:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Thermococcus kodakaraensis [TaxId: 311400]}
dgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlts
pwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvdv
vitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhvg
tagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
kwghvtp

Sequence, based on observed residues (ATOM records): (download)

>d1gehd1 c.1.14.1 (D:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Thermococcus kodakaraensis [TaxId: 311400]}
dgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlts
pwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvdv
vitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhvg
taeggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniqpviea
lgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaralekwghv
tp

SCOPe Domain Coordinates for d1gehd1:

Click to download the PDB-style file with coordinates for d1gehd1.
(The format of our PDB-style files is described here.)

Timeline for d1gehd1: