Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species) |
Species Archaeon Thermococcus kodakaraensis [TaxId:311400] [69731] (1 PDB entry) |
Domain d1geha2: 1geh A:12-136 [65182] Other proteins in same PDB: d1geha1, d1gehb1, d1gehc1, d1gehd1, d1gehe1 |
PDB Entry: 1geh (more details), 2.8 Å
SCOP Domain Sequences for d1geha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1geha2 d.58.9.1 (A:12-136) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis} yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek liref
Timeline for d1geha2: