Lineage for d1geha2 (1geh A:12-136)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412559Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 412560Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 412561Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (8 species)
  7. 412567Species Archaeon Thermococcus kodakaraensis [TaxId:311400] [69731] (1 PDB entry)
  8. 412568Domain d1geha2: 1geh A:12-136 [65182]
    Other proteins in same PDB: d1geha1, d1gehb1, d1gehc1, d1gehd1, d1gehe1

Details for d1geha2

PDB Entry: 1geh (more details), 2.8 Å

PDB Description: crystal structure of archaeal rubisco (ribulose 1,5-bisphosphate carboxylase/oxygenase)

SCOP Domain Sequences for d1geha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1geha2 d.58.9.1 (A:12-136) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis}
yvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwadls
akaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyfpek
liref

SCOP Domain Coordinates for d1geha2:

Click to download the PDB-style file with coordinates for d1geha2.
(The format of our PDB-style files is described here.)

Timeline for d1geha2: