SCOPe 2.07: Domain d1gckb_: 1gck B:

Lineage for d1gckb_ (1gck B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein Aspartate aminotransferase, AAT [53385] (9 species)

7. Species Thermus thermophilus [TaxId:274] [53391] (9 PDB entries)

8. Domain d1gckb_: 1gck B: [65178]
   complexed with asp, plp; mutant

Details for d1gckb_

PDB Entry: 1gck, 2.5 Å

PDB Description: thermus thermophilus aspartate aminotransferase double mutant 1 complexed with aspartate

PDB Compounds: (B:) aspartate aminotransferase

SCOPe Domain Sequences for d1gckb_:

Sequence; same for both SEQRES and ATOM records:

>d1gckb_ c.67.1.1 (B:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]}
mrglsrrvqamkpsatvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
rlsyatseenlrkalerfarvl

Timeline for d1gckb_:

• d1gckb_ first appeared in SCOP 1.59
  
• d1gckb_ appears in SCOPe 2.06
  
• d1gckb_ appears in the current release, SCOPe 2.08