Lineage for d1ga5b_ (1ga5 B:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204719Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 204720Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 204734Family g.39.1.2: Nuclear receptor [57721] (8 proteins)
  6. 204754Protein Orphan nuclear receptor reverb [57734] (1 species)
  7. 204755Species Human (Homo sapiens) [TaxId:9606] [57735] (3 PDB entries)
  8. 204759Domain d1ga5b_: 1ga5 B: [65174]

Details for d1ga5b_

PDB Entry: 1ga5 (more details), 2.4 Å

PDB Description: crystal structure of the orphan nuclear receptor rev-erb(alpha) dna- binding domain bound to its cognate response element

SCOP Domain Sequences for d1ga5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ga5b_ g.39.1.2 (B:) Orphan nuclear receptor reverb {Human (Homo sapiens)}
vllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcqqc
rfkkclsvgmsrdavrfgr

SCOP Domain Coordinates for d1ga5b_:

Click to download the PDB-style file with coordinates for d1ga5b_.
(The format of our PDB-style files is described here.)

Timeline for d1ga5b_: