![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.2: Virus ectodomain [58069] (2 families) ![]() |
![]() | Family h.3.2.1: Virus ectodomain [58070] (9 proteins) |
![]() | Protein Stalk of the ectodomain of NDV fusion glycoprotein [69983] (1 species) |
![]() | Species Newcastle disease virus [TaxId:11176] [69984] (1 PDB entry) |
![]() | Domain d1g5gf2: 1g5g F:67-223 [65166] Other proteins in same PDB: d1g5ga1, d1g5gb1, d1g5gc1, d1g5gd1, d1g5ge1, d1g5gf1 complexed with nag |
PDB Entry: 1g5g (more details), 3.3 Å
SCOPe Domain Sequences for d1g5gf2:
Sequence, based on SEQRES records: (download)
>d1g5gf2 h.3.2.1 (F:67-223) Stalk of the ectodomain of NDV fusion glycoprotein {Newcastle disease virus [TaxId: 11176]} pnmpkdkeacakapleaynrtlttlltplgdsirriqesvttsgggkqgrligaiiggva lgvataaqitaasaliqanqnaanilrlkesiaatneavhevtnglsqlavavgkmqqfv ndqfnktaqeldcikitqqvgvelnlyltelttvfgp
>d1g5gf2 h.3.2.1 (F:67-223) Stalk of the ectodomain of NDV fusion glycoprotein {Newcastle disease virus [TaxId: 11176]} pnmpkdkeacakapleaynrtlttlltplgdsirriqesglsqlavavgkmqqfvndqfn ktaqeldcikitqqvgvelnlyltelttvfgp
Timeline for d1g5gf2: