![]() | Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
![]() | Fold f.12: Head and neck region of the ectodomain of NDV fusion glycoprotein [69921] (1 superfamily) 3 intertwined all-beta domains |
![]() | Superfamily f.12.1: Head and neck region of the ectodomain of NDV fusion glycoprotein [69922] (1 family) ![]() |
![]() | Family f.12.1.1: Head and neck region of the ectodomain of NDV fusion glycoprotein [69923] (1 protein) |
![]() | Protein Head and neck region of the ectodomain of NDV fusion glycoprotein [69924] (1 species) |
![]() | Species Newcastle disease virus [TaxId:11176] [69925] (1 PDB entry) |
![]() | Domain d1g5gf1: 1g5g F:33-66,F:224-454 [65165] Other proteins in same PDB: d1g5ga2, d1g5gb2, d1g5gc2, d1g5gd2, d1g5ge2, d1g5gf2 complexed with man, nag |
PDB Entry: 1g5g (more details), 3.3 Å
SCOP Domain Sequences for d1g5gf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5gf1 f.12.1.1 (F:33-66,F:224-454) Head and neck region of the ectodomain of NDV fusion glycoprotein {Newcastle disease virus} dgrplaaagivvtgdkavniytssqtgsiiikllXqitspaltqltiqalynlaggnmdy lltklgvgnnqlsslissglitgnpilydsqtqllgiqvtlpsvgnlnnmratyletlsv sttkgfasalvpkvvtqvgsvieeldtsycietdldlyctrivtfpmspgiysclsgnts acmysktegalttpymtlkgsvianckmttcrcadppgiisqnygeavslidrqscnils ldgitlrlsgefdatyqknisiqdsq
Timeline for d1g5gf1: